Ver mas grande
ADIPOQ (Human) Recombinant Protein, Trimeric Form
AB-P8388
Producto nuevo
ADIPOQ (Human) Recombinant Protein, Trimeric Form
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | ADIPOQ |
| Gene Alias | ACDC|ACRP30|ADPN|APM-1|APM1|GBP28|adiponectin |
| Gene Description | adiponectin, C1Q and collagen domain containing |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4ºC for a limited period of time |
| Immunogen Prot. Seq | ETTTQGPGVLLPLPKGAATGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHIVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTNDYKDDDDK. |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from 0.05M phosphate buffer, 0.075M NaCl, pH 7.4. |
| Gene ID | 9370 |
Más información
Human ADIPOQ (Q15848) recombinant protein with FLAG-tag at C-terminal expressed in HEK293 cells.