Ver mas grande
ADIPOQ (Human) Recombinant Protein
AB-P8385
Producto nuevo
ADIPOQ (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 25 ug |
| Gene Name | ADIPOQ |
| Gene Alias | ACDC|ACRP30|ADPN|APM-1|APM1|GBP28|adiponectin |
| Gene Description | adiponectin, C1Q and collagen domain containing |
| Storage Conditions | Store, frozen at -20ºC for longer periods of time.<br>For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).<br>Avoid multiple freeze-thaw cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN. |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | 20mM Tris-HCl buffer (pH 8.0), 10% glycerol and 0.4M Urea. |
| Gene ID | 9370 |
Más información
Human ADIPOQ (Q15848, 108 a.a. - 244 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.