Ver mas grande
ACVR2A (Human) Recombinant Protein
AB-P8381
Producto nuevo
ACVR2A (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | ACVR2A |
| Gene Alias | ACTRII|ACVR2 |
| Gene Description | activin A receptor, type IIA |
| Storage Conditions | Store, frozen at -20ºC for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).<br>Avoid multiple freeze-thaw cycles.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | AILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPPLEHHHHHH. |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | Phosphate Buffered Saline (pH 7.4) and 10% glycerol |
| Gene ID | 92 |
Más información
HumanACVR2A (P27037) recombinant protein with His-tag at C-terminal expressed in Baculovirus.