INHBB (Human) Recombinant Protein
  • INHBB (Human) Recombinant Protein

INHBB (Human) Recombinant Protein

Ref: AB-P8378
INHBB (Human) Recombinant Protein

Información del producto

Human INHBB (P09529) recombinant protein with His-tag at N-terminal expressed in Nicotiana benthamiana expression system.
Información adicional
Size 2 x 10 ug
Gene Name INHBB
Gene Alias MGC157939
Gene Description inhibin, beta B
Storage Conditions Upon reconstitution should be stored at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq HHHHHHHHHHGLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECG
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 0.05M Tris-HCl buffer pH 7.4
Gene ID 3625

Enviar un mensaje


INHBB (Human) Recombinant Protein

INHBB (Human) Recombinant Protein