Ver mas grande
INHBB (Human) Recombinant Protein
AB-P8377
Producto nuevo
INHBB (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | INHBB |
| Gene Alias | MGC157939 |
| Gene Description | inhibin, beta B |
| Storage Conditions | Upon reconstitution should be stored at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | HHHHHHHHHHGLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECG. |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from 0.05M Tris-HCl buffer pH 7.4 |
| Gene ID | 3625 |
Más información
Human INHBB (P09529) recombinant protein with His-tag at N-terminal expressed in Nicotiana benthamiana expression system.