INHBA (Human) Recombinant Protein
  • INHBA (Human) Recombinant Protein

INHBA (Human) Recombinant Protein

Ref: AB-P8373
2 x 10 ug

Información del producto

INHBA (Human) Recombinant Protein
Información adicional
Size 2 x 10 ug
Gene Name INHBA
Gene Alias EDF|FRP
Gene Description inhibin, beta A
Storage Conditions Store, frozen at -20C for longer periods of time.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGLECDGKVNICCKKQFFVSFKDIGWNDWIIAPSGYHANYCEGECPSHIAGTSGSSLSFHSTVINHYRMRGHSPFANLKSCCVPTKLRPMSMLYYDDGQNIIKKDIQNMIVEECGCS.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 20mM Tris pH 8.0 and 10% glycerol
Gene ID 3624

Enviar un mensaje


INHBA (Human) Recombinant Protein

INHBA (Human) Recombinant Protein