Ver mas grande
INHBA (Human) Recombinant Protein
AB-P8373
Producto nuevo
INHBA (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | INHBA |
| Gene Alias | EDF|FRP |
| Gene Description | inhibin, beta A |
| Storage Conditions | Store, frozen at -20ºC for longer periods of time.<br>For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).<br>Avoid multiple freeze-thaw cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGLECDGKVNICCKKQFFVSFKDIGWNDWIIAPSGYHANYCEGECPSHIAGTSGSSLSFHSTVINHYRMRGHSPFANLKSCCVPTKLRPMSMLYYDDGQNIIKKDIQNMIVEECGCS. |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from 20mM Tris pH 8.0 and 10% glycerol |
| Gene ID | 3624 |
Más información
Human INHBA (P08476, 311 a.a. - 426 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli. expression system.