Il17a (Mouse) Recombinant Protein
  • Il17a (Mouse) Recombinant Protein

Il17a (Mouse) Recombinant Protein

Ref: AB-P8370
25 ug

Información del producto

Il17a (Mouse) Recombinant Protein
Información adicional
Size 25 ug
Gene Name Il17a
Gene Alias Ctla-8|Ctla8|Il17
Gene Description interleukin 17A
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water up to 1 mg/mL
Gene ID 16171

Enviar un mensaje


Il17a (Mouse) Recombinant Protein

Il17a (Mouse) Recombinant Protein