Il17a (Mouse) Recombinant Protein Ver mas grande

Il17a (Mouse) Recombinant Protein

AB-P8370

Producto nuevo

Il17a (Mouse) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 25 ug
Gene Name Il17a
Gene Alias Ctla-8|Ctla8|Il17
Gene Description interleukin 17A
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA
Form Lyophilized
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water up to 1 mg/mL
Gene ID 16171

Más información

Mouse Il17a (Q62386, 29 a.a. - 155 a.a.) partial recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

Il17a (Mouse) Recombinant Protein

Il17a (Mouse) Recombinant Protein