IL17A/F (Human) Recombinant Protein
  • IL17A/F (Human) Recombinant Protein

IL17A/F (Human) Recombinant Protein

Ref: AB-P8369
2 x 10 ug

Información del producto

IL17A/F (Human) Recombinant Protein
Información adicional
Size 2 x 10 ug
Gene Name IL17A
Gene Alias CTLA8|IL-17|IL-17A|IL17
Gene Description interleukin 17A
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAMRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVL
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water up to 1 mg/mL
Gene ID 3605|112744

Enviar un mensaje


IL17A/F (Human) Recombinant Protein

IL17A/F (Human) Recombinant Protein