Ver mas grande
IL17B (Human) Recombinant Protein
AB-P8360
Producto nuevo
IL17B (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 25 ug |
| Gene Name | IL17B |
| Gene Alias | IL-17B|IL-20|MGC138900|MGC138901|ZCYTO7 |
| Gene Description | interleukin 17B |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | Lyophilized from sterile distilled Water is > |
| Gene ID | 27190 |
Más información
Human IL17B (Q9UHF5, 20 a.a. - 180 a.a.) partial recombinant protein expressed in Escherichia coli.