IL15 (Human) Recombinant Protein
  • IL15 (Human) Recombinant Protein

IL15 (Human) Recombinant Protein

Ref: AB-P8347
IL15 (Human) Recombinant Protein

Información del producto

Human IL15 (P40933, 49 a.a. - 162 a.a.) partial recombinant protein with His tag at C-terminus expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name IL15
Gene Alias IL-15|MGC9721
Gene Description interleukin 15
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTSLEHHHHHH
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In 20mM Tris-HCl buffer pH 8.0 (0.2mM PMSF, 10% glycerol)
Gene ID 3600

Enviar un mensaje


IL15 (Human) Recombinant Protein

IL15 (Human) Recombinant Protein