Il12 (Mouse) Recombinant Protein
  • Il12 (Mouse) Recombinant Protein

Il12 (Mouse) Recombinant Protein

Ref: AB-P8333
Il12 (Mouse) Recombinant Protein

Información del producto

Mouse Il12 (P43431, 23 a.a. - 215 a.a., P43432, 23 a.a. - 335 a.a.) partial recombinant protein with Il12a His tag at C-terminus expressed in Sf9 cells.
Información adicional
Size 2 x 10 ug
Gene Name Il12a
Gene Alias IL-12p35|Il-12a|Ll12a|MGC151228|MGC151232|p35
Gene Description interleukin 12a
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq RVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRV_x005F_x000D__x000D_VTINRVMGYLSSAHHHHHHMWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDI
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (10% glycerol)
Gene ID 16159|16160

Enviar un mensaje


Il12 (Mouse) Recombinant Protein

Il12 (Mouse) Recombinant Protein