Il11ra1 (Rat) Recombinant Protein
  • Il11ra1 (Rat) Recombinant Protein

Il11ra1 (Rat) Recombinant Protein

Ref: AB-P8325
Il11ra1 (Rat) Recombinant Protein

Información del producto

Rat Il11ra1 (Q99MF4, 21 a.a. - 199 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Información adicional
Size 5 ug
Gene Name Il11ra1
Gene Alias -
Gene Description interleukin 11 receptor, alpha chain 1
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq TPCPQAWGPPGVQYGQPGRPVMLCCPGVNAGTPVSWFRDGDSRLLQGPDSGLGHRLVLAQVDSRDEGTYVCRTLDGVFGGMVTLKLGSPPARPEVSCQAVDYENFSCTWSPGRVSGLPTRYLTSYRKKTLPGAESQRESPSTGPWPCPQDPLEASRCVVHGAEFWSEYRINVTEVNPLGASTCLLDVRLQRILRPDPPQGLRVESVPGYPRRLHASWTYPASWRRQPHFLLKFRLQYRPAQHPAWSTVEPIGLEE
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (10% glycerol)
Gene ID 245983

Enviar un mensaje


Il11ra1 (Rat) Recombinant Protein

Il11ra1 (Rat) Recombinant Protein