Il9 (Rat) Recombinant Protein
  • Il9 (Rat) Recombinant Protein

Il9 (Rat) Recombinant Protein

Ref: AB-P8313
Il9 (Rat) Recombinant Protein

Información del producto

Rat Il9 (D4A8I9, 19 a.a. - 144 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name Il9
Gene Alias -
Gene Description interleukin 9
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QRCSTSWGIQHTSYLIENLKDDPSSKCSCSANVTSCLCLPIPSDDCTTPCFQEGMSQVTNATQQSKFSPFFFRVKRIVETLKSNKCQFFSCEKPCNQTTAGNTVSFLKSLLKTFQKTEVQVQRSRA
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 116558

Enviar un mensaje


Il9 (Rat) Recombinant Protein

Il9 (Rat) Recombinant Protein