IL7 (Human) Recombinant Protein
  • IL7 (Human) Recombinant Protein

IL7 (Human) Recombinant Protein

Ref: AB-P8305
IL7 (Human) Recombinant Protein

Información del producto

Human IL7 (P13232, 26 a.a. - 177 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Información adicional
Size 2 x 10 ug
Gene Name IL7
Gene Alias IL-7
Gene Description interleukin 7
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq ADPDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEHHHHHHH
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (10% glycerol)
Gene ID 3574

Enviar un mensaje


IL7 (Human) Recombinant Protein

IL7 (Human) Recombinant Protein