IL6R (Human) Recombinant Protein
  • IL6R (Human) Recombinant Protein

IL6R (Human) Recombinant Protein

Ref: AB-P8297
IL6R (Human) Recombinant Protein

Información del producto

Human IL6R (P08887, 20 a.a. - 357 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name IL6R
Gene Alias CD126|IL-6R-1|IL-6R-alpha|IL6RA|MGC104991
Gene Description interleukin 6 receptor
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQ
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In 20mM Tris-HCl buffer pH 8.0 (0.8M Urea, 50% glycerol)
Gene ID 3570

Enviar un mensaje


IL6R (Human) Recombinant Protein

IL6R (Human) Recombinant Protein