Il5ra (Mouse) Recombinant Protein
  • Il5ra (Mouse) Recombinant Protein

Il5ra (Mouse) Recombinant Protein

Ref: AB-P8286
Il5ra (Mouse) Recombinant Protein

Información del producto

Mouse Il5ra (P21183, 18 a.a. - 339 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Información adicional
Size 2 x 10 ug
Gene Name Il5ra
Gene Alias CD125|CDw125|Il5r
Gene Description interleukin 5 receptor, alpha
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq DLLNHKKFLLLPPVNFTIKATGLAQVLLHWDPNPDQEQRHVDLEYHVKINAPQEDEYDTRKTESKCVTPLHEGFAASVRTILKSSHTTLASSWVSAELKAPPGSPGTSVTNLTCTTHTVVSSHTHLRPYQVSLRCTWLVGKDAPEDTQYFLYYRFGVLTEKCQEYSRDALNRNTACWFPRTFINSKGFEQLAVHINGSSKRAAIKPFDQLFSPLAIDQVNPPRNVTVEIESNSLYIQWEKPLSAFPDHCFNYELK
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (10% glycerol)
Gene ID 16192

Enviar un mensaje


Il5ra (Mouse) Recombinant Protein

Il5ra (Mouse) Recombinant Protein