Il5 (Mouse) Recombinant Protein Ver mas grande

Il5 (Mouse) Recombinant Protein

AB-P8280

Producto nuevo

Il5 (Mouse) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.


Hoja técnica

Size 2 x 10 ug
Gene Name Il5
Gene Alias Il-5
Gene Description interleukin 5
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq DGSMEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEGHHHHHH
Form Liquid
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (10% glycerol)
Gene ID 16191

Más información

Mouse Il5 (P04401, 21 a.a. - 133 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.

Consulta sobre un producto

Il5 (Mouse) Recombinant Protein

Il5 (Mouse) Recombinant Protein