IL4I1 (Human) Recombinant Protein
  • IL4I1 (Human) Recombinant Protein

IL4I1 (Human) Recombinant Protein

Ref: AB-P8276
IL4I1 (Human) Recombinant Protein

Información del producto

Human IL4I1 (Q96RQ9, 26 a.a. - 232 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Información adicional
Size 2 x 10 ug
Gene Name IL4I1
Gene Alias FIG1
Gene Description interleukin 4 induced 1
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq ADLQDWKAERSQDPFEKCMQDPDYEQLLKVVTWGLNRTLKPQRVIVVGAGVAGLVAAKVLSDAGHKVTILEADNRIGGRIFTYRDQNTGWIGELGAMRMPSSHRILHKLCQGLGLNLTKFTQYDKNTWTEVHEVKLRNYVVEKVPEKLGYALRPQEKGHSPEDIYQMALNQALKDLKALGCRKAMKKFERHTLLEYLLGEGNLSRPAVQLLGDVMSEDGFFYLSFAEALRAHSCLSDRLQYSRIVGGWDLLPRAL
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In 25mM MES pH-5.5 (100mM NaCl, 40% glycerol)
Gene ID 259307

Enviar un mensaje


IL4I1 (Human) Recombinant Protein

IL4I1 (Human) Recombinant Protein