Il4 (Mouse) Recombinant Protein
  • Il4 (Mouse) Recombinant Protein

Il4 (Mouse) Recombinant Protein

Ref: AB-P8269
Il4 (Mouse) Recombinant Protein

Información del producto

Mouse Il4 (P07750, 21 a.a. - 140 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name Il4
Gene Alias Il-4
Gene Description interleukin 4
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MHIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In sterile 10mM HAc >
Gene ID 16189

Enviar un mensaje


Il4 (Mouse) Recombinant Protein

Il4 (Mouse) Recombinant Protein