IL3 (Canine) Recombinant Protein Ver mas grande

IL3 (Canine) Recombinant Protein

AB-P8262

Producto nuevo

IL3 (Canine) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.


Hoja técnica

Size 2 x 10 ug
Gene Name IL3
Gene Alias -
Gene Description interleukin 3 (colony-stimulating factor, multiple)
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq RPFSTDLPKQYFTMINEIMEMLNKSPSPSEEPLDSNEKETLLEDTLLRPNLDVFLNASSKFHKNGLLIWNNLKEFLPLLPTPTPRGEPISIMENNWGDFQRKLKKYLEALDNFLNFKNKP
Form Lyophilized
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is &gt
Gene ID 481497

Más información

Canine IL3 (Q9BDX4, 24 a.a. - 143 a.a.) partial recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

IL3 (Canine) Recombinant Protein

IL3 (Canine) Recombinant Protein