IL3 (Human) Recombinant Protein
  • IL3 (Human) Recombinant Protein

IL3 (Human) Recombinant Protein

Ref: AB-P8257
IL3 (Human) Recombinant Protein

Información del producto

Human IL3 (P08700, 20 a.a. - 152 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name IL3
Gene Alias IL-3|MCGF|MGC79398|MGC79399|MULTI-CSF
Gene Description interleukin 3 (colony-stimulating factor, multiple)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMAPMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In 20mM Tris-HCl buffer pH 8.0 (0.2mM PMSF, 10% glycerol)
Gene ID 3562

Enviar un mensaje


IL3 (Human) Recombinant Protein

IL3 (Human) Recombinant Protein