IL2 (Porcine) Recombinant Protein
  • IL2 (Porcine) Recombinant Protein

IL2 (Porcine) Recombinant Protein

Ref: AB-P8246
IL2 (Porcine) Recombinant Protein

Información del producto

Porcine IL2 (P26891, 21 a.a. - 154 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name IL2
Gene Alias IL-2|POIL2
Gene Description interleukin 2
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq APTSSSTKNTKKQLEPLLLDLQLLLKEVKNYENADLSRMLTFKFYMPKQATELKHLQCLVEELKALEGVLNLGQSKNSDSANIKESMNNINVTVLELKGSETSFKCEYDDETVTAVEFLNKWITFCQSIYSTLT
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 396868

Enviar un mensaje


IL2 (Porcine) Recombinant Protein

IL2 (Porcine) Recombinant Protein