IL1RN (Horse) Recombinant Protein Ver mas grande

IL1RN (Horse) Recombinant Protein

AB-P8238

Producto nuevo

IL1RN (Horse) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 100 ug
Gene Name IL1RN
Gene Alias IL-1RA
Gene Description interleukin 1 receptor antagonist
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq HPLGKRPCKMQAFRIWDVNQKTFYMRNNQLVAGYLQESNTKLQEKIDVVPIEPDALFLGLHGRKLCLACVKSGDEIRFQLEAVNITDLSKNKEENKRFTFIRSNSGPTTSFESAACPGWFLCTAQEADRPVSLTNKPKESFMVTKFYLQEDQ
Form Lyophilized
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is &gt
Gene ID 100034236

Más información

Horse IL1RN (O18999, 26 a.a. - 177 a.a.) partial recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

IL1RN (Horse) Recombinant Protein

IL1RN (Horse) Recombinant Protein