Il1rn (Rat) Recombinant Protein
  • Il1rn (Rat) Recombinant Protein

Il1rn (Rat) Recombinant Protein

Ref: AB-P8237
Il1rn (Rat) Recombinant Protein

Información del producto

Rat Il1rn (P25086, 27 a.a. - 178 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name Il1rn
Gene Alias IL-1ra
Gene Description interleukin 1 receptor antagonist
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSHPAGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNTKLEEKIDMVPIDFRNVFLGIHGGKLCLSCVKSGDDTKLQLEEVNITDLNKNKEEDKRFTFIRSETGPTTSFESLACPGWFLCTTLEADHPVSLTNTPKEPCTVTKFYFQEDQ
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (1mM DTT, 10% glycerol)
Gene ID 60582

Enviar un mensaje


Il1rn (Rat) Recombinant Protein

Il1rn (Rat) Recombinant Protein