IL1RL1 (Human) Recombinant Protein Ver mas grande

IL1RL1 (Human) Recombinant Protein

AB-P8231

Producto nuevo

IL1RL1 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.


Hoja técnica

Size 2 x 10 ug
Gene Name IL1RL1
Gene Alias DER4|FIT-1|MGC32623|ST2|ST2L|ST2V|T1
Gene Description interleukin 1 receptor-like 1
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQN
Form Liquid
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (10% glycerol)
Gene ID 9173

Más información

Human IL1RL1 (Q01638, 19 a.a. - 328 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.

Consulta sobre un producto

IL1RL1 (Human) Recombinant Protein

IL1RL1 (Human) Recombinant Protein