IL1RN (Human) Recombinant Protein
  • IL1RN (Human) Recombinant Protein

IL1RN (Human) Recombinant Protein

Ref: AB-P8229
IL1RN (Human) Recombinant Protein

Información del producto

Human IL1RN (P18510, 26 a.a. - 177 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name IL1RN
Gene Alias ICIL-1RA|IL-1ra3|IL1F3|IL1RA|IRAP|MGC10430
Gene Description interleukin 1 receptor antagonist
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In 20mM Tris pH 8.0 (50% glycerol)
Gene ID 3557

Enviar un mensaje


IL1RN (Human) Recombinant Protein

IL1RN (Human) Recombinant Protein