IL1B (Canine) Recombinant Protein
  • IL1B (Canine) Recombinant Protein

IL1B (Canine) Recombinant Protein

Ref: AB-P8227
IL1B (Canine) Recombinant Protein

Información del producto

Canine IL1B (Q28292, 114 a.a. - 265 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name IL1B
Gene Alias IL-1
Gene Description interleukin 1, beta
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MAAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4
Gene ID 403974

Enviar un mensaje


IL1B (Canine) Recombinant Protein

IL1B (Canine) Recombinant Protein