IL1B (Human) Recombinant Protein
  • IL1B (Human) Recombinant Protein

IL1B (Human) Recombinant Protein

Ref: AB-P8218
IL1B (Human) Recombinant Protein

Información del producto

Human IL1B (P01584, 117 a.a. - 269 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name IL1B
Gene Alias IL-1|IL1-BETA|IL1F2
Gene Description interleukin 1, beta
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFV_x005F_x000D__x000D__x005F_x000D__x000D_QGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKME_x005F_x000D__x000D__x005F_x000D__x000D_KRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In 20mM Tris-HCl buffer pH 8.0 (50% glycerol)
Gene ID 3553

Enviar un mensaje


IL1B (Human) Recombinant Protein

IL1B (Human) Recombinant Protein