Ver mas grande
IL1A (Human) Recombinant Protein
AB-P8205
Producto nuevo
IL1A (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | IL1A |
| Gene Alias | IL-1A|IL1|IL1-ALPHA|IL1F1 |
| Gene Description | interleukin 1, alpha |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | HHHHHHSAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In 1X PBS (50% glycerol) |
| Gene ID | 3552 |
Más información
Human IL1A (P01583, 113 a.a. - 271 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.