Ihh (Mouse) Recombinant Protein
  • Ihh (Mouse) Recombinant Protein

Ihh (Mouse) Recombinant Protein

Ref: AB-P8203
Ihh (Mouse) Recombinant Protein

Información del producto

Mouse Ihh (P97812, 27 a.a. - 202 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 25 ug
Gene Name Ihh
Gene Alias -
Gene Description Indian hedgehog
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq IIGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKAHVHCSVKSEHSAAAKTGG
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 16147

Enviar un mensaje


Ihh (Mouse) Recombinant Protein

Ihh (Mouse) Recombinant Protein