IGFBP1 (Human) Recombinant Protein
  • IGFBP1 (Human) Recombinant Protein

IGFBP1 (Human) Recombinant Protein

Ref: AB-P8191
IGFBP1 (Human) Recombinant Protein

Información del producto

Human IGFBP1 (P08833, 26 a.a. - 259 a.a.) partial recombinant protein expressed in Mouse myeloma cell line.
Información adicional
Size 25 ug
Gene Name IGFBP1
Gene Alias AFBP|IBP1|IGF-BP25|PP12|hIGFBP-1
Gene Description insulin-like growth factor binding protein 1
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq APWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 3484

Enviar un mensaje


IGFBP1 (Human) Recombinant Protein

IGFBP1 (Human) Recombinant Protein