SIRPG (Human) Recombinant Protein
  • SIRPG (Human) Recombinant Protein

SIRPG (Human) Recombinant Protein

Ref: AB-P8110
SIRPG (Human) Recombinant Protein

Información del producto

Human SIRPG (Q9P1W8, 29 a.a. - 360 a.a.) partial length recombinant protein hIgG-His tag expressed in Baculovirus expression system.
Información adicional
Size 100 ug
Gene Name SIRPG
Gene Alias CD172g|SIRP-B2|SIRPB2|SIRPgamma|bA77C3.1
Gene Description signal-regulatory protein gamma
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq EEELQMIQPEKLLLVTVGKTATLHCTVTSLLPVGPVLWFRGVGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRISSITPADVGTYYCVKFRKGSPENVEFKSGPGTEMALGAKPSAPVVLGPAARTTPEHTVSFTCESHGFSPRDITLKWFKNGNELSDFQTNVDPTGQSVAYSIRSTARVVLDPWDVRSQVICEVAHVTLQGDPLRGTANLSEAIRVPPTLEVTQQPMRVGNQVNVTCQVRKFYPQSLQL
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (40% glycerol)
Gene ID 55423

Enviar un mensaje


SIRPG (Human) Recombinant Protein

SIRPG (Human) Recombinant Protein