CD6 (Human) Recombinant Protein
  • CD6 (Human) Recombinant Protein

CD6 (Human) Recombinant Protein

Ref: AB-P8097
CD6 (Human) Recombinant Protein

Información del producto

Human CD6 (P30203, 18 a.a. - 402 a.a.) partial length recombinant protein hIgG-His tag expressed in Baculovirus expression system.
Información adicional
Size 100 ug
Gene Name CD6
Gene Alias FLJ44171|TP120
Gene Description CD6 molecule
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq HPSPAPPDQLNTSSAESELWEPGERLPVRLTNGSSSCSGTVEVRLEASWEPACGALWDSRAAEAVCRALGCGGAEAASQLAPPTPELPPPPAAGNTSVAANATLAGAPALLCSGAEWRLCEVVEHACRSDGRRARVTCAENRALRLVDGGGACAGRVEMLEHGEWGSVCDDTWDLEDAHVVCRQLGCGWAVQALPGLHFTPGRGPIHRDQVNCSGAEAYLWDCPGLPGQHYCGHKEDAGAVCSEHQSWRLTGGAD
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 923

Enviar un mensaje


CD6 (Human) Recombinant Protein

CD6 (Human) Recombinant Protein