CHST3 (Human) Recombinant Protein Ver mas grande

CHST3 (Human) Recombinant Protein

AB-P8096

Producto nuevo

CHST3 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 8 Biopuntos. Su cesta contiene un total 8 Biopuntos puede ser convertido en un Biobonos Descuento 32.00EUR.


Hoja técnica

Size 100 ug
Gene Name CHST3
Gene Alias C6ST|C6ST1|HSD
Gene Description carbohydrate (chondroitin 6) sulfotransferase 3
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq EKENKIISRVSDKLKQIPQALADANSTDPALILAENASLLSLSELDSAFSQLQSRLRNLSLQLGVEPAMEAAGEEEEEQRKEEEPPRPAVAGPRRHVLLMATTRTGSSFVGEFFNQQGNIFYLFEPLWHIERTVSFEPGGANAAGSALVYRDVLKQLFLCDLYVLEHFITPLPEDHLTQFMFRRGSSRSLCEDPVCTPFVKKVFEKYHCKNRRCGPLNVTLAAEACRRKEHMALKAVRIRQLEFLQPLAEDPRLD
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 9469

Más información

Human CHST3 (Q7LGC8, 39 a.a. - 479 a.a.) partial length recombinant protein His tag expressed in Baculovirus expression system.

Consulta sobre un producto

CHST3 (Human) Recombinant Protein

CHST3 (Human) Recombinant Protein