CHST3 (Human) Recombinant Protein
  • CHST3 (Human) Recombinant Protein

CHST3 (Human) Recombinant Protein

Ref: AB-P8096
CHST3 (Human) Recombinant Protein

Información del producto

Human CHST3 (Q7LGC8, 39 a.a. - 479 a.a.) partial length recombinant protein His tag expressed in Baculovirus expression system.
Información adicional
Size 100 ug
Gene Name CHST3
Gene Alias C6ST|C6ST1|HSD
Gene Description carbohydrate (chondroitin 6) sulfotransferase 3
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq EKENKIISRVSDKLKQIPQALADANSTDPALILAENASLLSLSELDSAFSQLQSRLRNLSLQLGVEPAMEAAGEEEEEQRKEEEPPRPAVAGPRRHVLLMATTRTGSSFVGEFFNQQGNIFYLFEPLWHIERTVSFEPGGANAAGSALVYRDVLKQLFLCDLYVLEHFITPLPEDHLTQFMFRRGSSRSLCEDPVCTPFVKKVFEKYHCKNRRCGPLNVTLAAEACRRKEHMALKAVRIRQLEFLQPLAEDPRLD
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 9469

Enviar un mensaje


CHST3 (Human) Recombinant Protein

CHST3 (Human) Recombinant Protein