Chst5 (Mouse) Recombinant Protein
  • Chst5 (Mouse) Recombinant Protein

Chst5 (Mouse) Recombinant Protein

Ref: AB-P8095
Chst5 (Mouse) Recombinant Protein

Información del producto

Mouse Chst5 (Q9QUP4, 27 a.a. - 395 a.a.) partial length recombinant protein His tag expressed in Baculovirus expression system.
Información adicional
Size 100 ug
Gene Name Chst5
Gene Alias AI173964|GST-4|I-GlcNAc-6-ST
Gene Description carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 5
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SRQVPSSPAGLGERVHVLVLSSWRSGSSFVGQLFSQHPDVFYLMEPAWHVWDTLSQGSAPALHMAVRDLIRSVFLCDMDVFDAYLPWRRNISDLFQWAVSRALCSPPVCEAFARGNISSEEVCKPLCATRPFGLAQEACSSYSHVVLKEVRFFNLQVLYPLLSDPALNLRIVHLVRDPRAVLRSREQTAKALARDNGIVLGTNGTWVEADPRLRVVNEVCRSHVRIAEAALHKPPPFLQDRYRLVRYEDLARDPL
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (20% glycerol)
Gene ID 56773

Enviar un mensaje


Chst5 (Mouse) Recombinant Protein

Chst5 (Mouse) Recombinant Protein