Lifr (Mouse) Recombinant Protein
  • Lifr (Mouse) Recombinant Protein

Lifr (Mouse) Recombinant Protein

Ref: AB-P8078
Lifr (Mouse) Recombinant Protein

Información del producto

Mouse Lifr (P42703, 44 a.a. - 828 a.a.) partial length recombinant protein His tag expressed in Baculovirus expression system.
Información adicional
Size 100 ug
Gene Name Lifr
Gene Alias A230075M04Rik|AW061234|LIF
Gene Description leukemia inhibitory factor receptor
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq LKRGVQDLKCTTNNMRVWDCTWPAPLGVSPGTVKDICIKDRFHSCHPLETTNVKIPALSPGDHEVTINYLNGFQSKFTLNEKDVSLIPETPEILDLSADFFTSSLLLKWNDRGSALPHPSNATWEIKVLQNPRTEPVALVLLNTMLSGKDTVQHWNWTSDLPLQCATHSVSIRWHIDSPHFSGYKEWSDWSPLKNISWIRNTETNVFPQDKVVLAGSNMTICCMSPTKVLSGQIGNTLRPLIHLYGQTVAIHILN
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 16880

Enviar un mensaje


Lifr (Mouse) Recombinant Protein

Lifr (Mouse) Recombinant Protein