ICAM3 (Human) Recombinant Protein
  • ICAM3 (Human) Recombinant Protein

ICAM3 (Human) Recombinant Protein

Ref: AB-P8071
ICAM3 (Human) Recombinant Protein

Información del producto

Human ICAM3 (P32942, 30 a.a. - 485 a.a.) partial length recombinant protein hIgG-His tag expressed in Baculovirus expression system.
Información adicional
Size 100 ug
Gene Name ICAM3
Gene Alias CD50|CDW50|ICAM-R
Gene Description intercellular adhesion molecule 3
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QEFLLRVEPQNPVLSAGGSLFVNCSTDCPSSEKIALETSLSKELVASGMGWAAFNLSNVTGNSRILCSVYCNGSQITGSSNITVYRLPERVELAPLPPWQPVGQNFTLRCQVEDGSPRTSLTVVLLRWEEELSRQPAVEEPAEVTATVLASRDDHGAPFSCRTELDMQPQGLGLFVNTSAPRQLRTFVLPVTPPRLVAPRFLEVETSWPVDCTLDGLFPASEAQVYLALGDQMLNATVMNHGDTLTATATATARA
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 3385

Enviar un mensaje


ICAM3 (Human) Recombinant Protein

ICAM3 (Human) Recombinant Protein