ICAM3 (Human) Recombinant Protein Ver mas grande

ICAM3 (Human) Recombinant Protein

AB-P8071

Producto nuevo

ICAM3 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.


Hoja técnica

Size 100 ug
Gene Name ICAM3
Gene Alias CD50|CDW50|ICAM-R
Gene Description intercellular adhesion molecule 3
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq QEFLLRVEPQNPVLSAGGSLFVNCSTDCPSSEKIALETSLSKELVASGMGWAAFNLSNVTGNSRILCSVYCNGSQITGSSNITVYRLPERVELAPLPPWQPVGQNFTLRCQVEDGSPRTSLTVVLLRWEEELSRQPAVEEPAEVTATVLASRDDHGAPFSCRTELDMQPQGLGLFVNTSAPRQLRTFVLPVTPPRLVAPRFLEVETSWPVDCTLDGLFPASEAQVYLALGDQMLNATVMNHGDTLTATATATARA
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 3385

Más información

Human ICAM3 (P32942, 30 a.a. - 485 a.a.) partial length recombinant protein hIgG-His tag expressed in Baculovirus expression system.

Consulta sobre un producto

ICAM3 (Human) Recombinant Protein

ICAM3 (Human) Recombinant Protein