MME (Human) Recombinant Protein
  • MME (Human) Recombinant Protein

MME (Human) Recombinant Protein

Ref: AB-P8061
MME (Human) Recombinant Protein

Información del producto

Human MEE (P08473, 52 a.a. - 750 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system.
Información adicional
Size 100 ug
Gene Name MME
Gene Alias CALLA|CD10|DKFZp686O16152|MGC126681|MGC126707|NEP
Gene Description membrane metallo-endopeptidase
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq YDDGICKSSDCIKSAARLIQNMDATTEPCTDFFKYACGGWLKRNVIPETSSRYGNFDILRDELEVVLKDVLQEPKTEDIVAVQKAKALYRSCINESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGASWTAEKAIAQLNSKYGKKVLINLFVGTDDKNSVNHVIHIDQPRLGLPSRDYYECTGIYKEACTAYVDFMISVARLIRQEERLPIDENQLALEMNKVMELEKEIANATAKPEDRNDPMLLYNKMTLA
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In 20mM Tris-HCl pH 8.0 (10% glycerol, 100 mM NaCl, 1 mM PMSF)
Gene ID 4311

Enviar un mensaje


MME (Human) Recombinant Protein

MME (Human) Recombinant Protein