Ver mas grande
MME (Human) Recombinant Protein
AB-P8061
Producto nuevo
MME (Human) Recombinant Protein
Comprando este producto generará 7 Biopuntos. Su cesta contiene un total 7 Biopuntos puede ser convertido en un Biobonos Descuento 28.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | MME |
| Gene Alias | CALLA|CD10|DKFZp686O16152|MGC126681|MGC126707|NEP |
| Gene Description | membrane metallo-endopeptidase |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | YDDGICKSSDCIKSAARLIQNMDATTEPCTDFFKYACGGWLKRNVIPETSSRYGNFDILRDELEVVLKDVLQEPKTEDIVAVQKAKALYRSCINESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGASWTAEKAIAQLNSKYGKKVLINLFVGTDDKNSVNHVIHIDQPRLGLPSRDYYECTGIYKEACTAYVDFMISVARLIRQEERLPIDENQLALEMNKVMELEKEIANATAKPEDRNDPMLLYNKMTLA |
| Form | Liquid |
| Quality control testing | 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain. |
| Storage Buffer | In 20mM Tris-HCl pH 8.0 (10% glycerol, 100 mM NaCl, 1 mM PMSF) |
| Gene ID | 4311 |
Más información
Human MEE (P08473, 52 a.a. - 750 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system.