Csf1 (Mouse) Recombinant Protein
  • Csf1 (Mouse) Recombinant Protein

Csf1 (Mouse) Recombinant Protein

Ref: AB-P8060
Csf1 (Mouse) Recombinant Protein

Información del producto

Mouse Csf1 (P07141, 33 a.a. - 187 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system.
Información adicional
Size 100 ug
Gene Name Csf1
Gene Alias C87615|CSF-1|Csfm|M-CSF|op
Gene Description colony stimulating factor 1 (macrophage)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 12977

Enviar un mensaje


Csf1 (Mouse) Recombinant Protein

Csf1 (Mouse) Recombinant Protein