GALNT1 (Human) Recombinant Protein
  • GALNT1 (Human) Recombinant Protein

GALNT1 (Human) Recombinant Protein

Ref: AB-P8057
GALNT1 (Human) Recombinant Protein

Información del producto

Human GALNT1 (Q10472, 41 a.a. - 559 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system.
Información adicional
Size 100 ug
Gene Name GALNT1
Gene Alias GALNAC-T1
Gene Description UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 (GalNAc-T1)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq GLPAGDVLEPVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVPVHVIRMEQRSGLIRARLKGAAVSKGQVITFLDAHCECTVGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGL
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In 20mM Tris-HCl pH 8.0 (10% glycerol, 0.1 M NaCl)
Gene ID 2589

Enviar un mensaje


GALNT1 (Human) Recombinant Protein

GALNT1 (Human) Recombinant Protein