CSF1R (Human) Recombinant Protein
  • CSF1R (Human) Recombinant Protein

CSF1R (Human) Recombinant Protein

Ref: AB-P8048
CSF1R (Human) Recombinant Protein

Información del producto

Human CSF1R (P07333, 20 a.a. - 517 a.a.) partial length recombinant protein with hIgG-His tag expressed in Baculovirus expression system.
Información adicional
Size 20 ug
Gene Name CSF1R
Gene Alias C-FMS|CD115|CSFR|FIM2|FMS
Gene Description colony stimulating factor 1 receptor
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq IPVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTLYSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFEDQDALLPCLLTDPVLEAGVSLVRVRGRPLMRHTNYSFSPWHGFTIHRAKFIQSQDYQCSALMGGRKVMSISIRLKVQKVIPGPPALTLVPAELVRIRGEAAQIVCSASSVDVNFDVFLQHNNTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAG
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 1436

Enviar un mensaje


CSF1R (Human) Recombinant Protein

CSF1R (Human) Recombinant Protein