Il12b/Il12a (Mouse) Recombinant Protein
  • Il12b/Il12a (Mouse) Recombinant Protein

Il12b/Il12a (Mouse) Recombinant Protein

Ref: AB-P8041
Il12b/Il12a (Mouse) Recombinant Protein

Información del producto

Mouse Il12b/Il12a (P43432/P43431, 23 a.a. - 335 a.a./23 a.a. - 215 a.a. ) partial length recombinant protein with His tag expressed in Baculovirus expression system.
Información adicional
Size 50 ug
Gene Name Il12b
Gene Alias Il-12b|Il-12p40|Il12p40|p40
Gene Description interleukin 12b
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRK
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 16160/16159

Enviar un mensaje


Il12b/Il12a (Mouse) Recombinant Protein

Il12b/Il12a (Mouse) Recombinant Protein