ALDOC (Human) Recombinant Protein Ver mas grande

ALDOC (Human) Recombinant Protein

AB-P8034

Producto nuevo

ALDOC (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.


Hoja técnica

Size 20 ug
Gene Name ALDOC
Gene Alias ALDC
Gene Description aldolase C, fructose-bisphosphate
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRVKKCIGGVIFFHETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTDGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKISERTPSALAILENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHACPIKYTPEEIAMATVT
Form Liquid
Antigen species Target species Escherichia coli
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In 20mM Tris-HCl pH 8.0 (20% glycerol, 0.1 M NaCl, 2 mM DTT)
Gene ID 230

Más información

Human ALDOC (P09972, 1 a.a. - 364 a.a.) full length recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

ALDOC (Human) Recombinant Protein

ALDOC (Human) Recombinant Protein