Prdx2 (Mouse) Recombinant Protein
  • Prdx2 (Mouse) Recombinant Protein

Prdx2 (Mouse) Recombinant Protein

Ref: AB-P8029
Prdx2 (Mouse) Recombinant Protein

Información del producto

Mouse Prdx2 (Q61171, 1 a.a. - 198 a.a.) full length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name Prdx2
Gene Alias AL022839|Band-8|NkefB|PRP|PrxII|TDX1|TPx|TPx-B|TR|TSA|Tdpx1|Torin
Gene Description peroxiredoxin 2
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MASGNAQIGKSAPDFTATAVVDGAFKEIKLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSDHAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKNDEGIAYRGLFIIDAKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In 20mM Tris-HCl pH 8.0 (10% glycerol, 1 mM DTT)
Gene ID 21672

Enviar un mensaje


Prdx2 (Mouse) Recombinant Protein

Prdx2 (Mouse) Recombinant Protein