Ver mas grande
Prdx2 (Mouse) Recombinant Protein
AB-P8029
Producto nuevo
Prdx2 (Mouse) Recombinant Protein
Comprando este producto generará 5 Biopuntos. Su cesta contiene un total 5 Biopuntos puede ser convertido en un Biobonos Descuento 20.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | Prdx2 |
| Gene Alias | AL022839|Band-8|NkefB|PRP|PrxII|TDX1|TPx|TPx-B|TR|TSA|Tdpx1|Torin |
| Gene Description | peroxiredoxin 2 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MASGNAQIGKSAPDFTATAVVDGAFKEIKLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSDHAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKNDEGIAYRGLFIIDAKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN |
| Form | Liquid |
| Quality control testing | 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain. |
| Storage Buffer | In 20mM Tris-HCl pH 8.0 (10% glycerol, 1 mM DTT) |
| Gene ID | 21672 |
Más información
Mouse Prdx2 (Q61171, 1 a.a. - 198 a.a.) full length recombinant protein with His tag expressed in Escherichia coli.