Pdia3 (Mouse) Recombinant Protein
  • Pdia3 (Mouse) Recombinant Protein

Pdia3 (Mouse) Recombinant Protein

Ref: AB-P8022
Pdia3 (Mouse) Recombinant Protein

Información del producto

Mouse Pdia3 (P27773, 25 a.a. - 505 a.a.) partial length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name Pdia3
Gene Alias 58kDa|ERp57|ERp60|ERp61|Erp|Grp58|PDI|PDI-Q2|PI-PLC|PLC[a]|Plca
Gene Description protein disulfide isomerase associated 3
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SDVLELTDENFESRVSDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASVVGFFRDLFSDGHSEFLKAASNLRDNYRFAHTNIESLVKEYDDNGEGITIFRPLHLANKFEDKTVAYTEKKMTSGKIKKFIQDSIFGLCPHMTEDNKDLIQGKDLLTAYYDVDYEKNAKGSNYW
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In 20mM Tris-HCl pH 8.0 (10% glycerol, 0.1 M NaCl, 1 mM DTT)
Gene ID 14827

Enviar un mensaje


Pdia3 (Mouse) Recombinant Protein

Pdia3 (Mouse) Recombinant Protein