Ver mas grande
Pdia3 (Mouse) Recombinant Protein
AB-P8022
Producto nuevo
Pdia3 (Mouse) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | Pdia3 |
| Gene Alias | 58kDa|ERp57|ERp60|ERp61|Erp|Grp58|PDI|PDI-Q2|PI-PLC|PLC[a]|Plca |
| Gene Description | protein disulfide isomerase associated 3 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | SDVLELTDENFESRVSDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASVVGFFRDLFSDGHSEFLKAASNLRDNYRFAHTNIESLVKEYDDNGEGITIFRPLHLANKFEDKTVAYTEKKMTSGKIKKFIQDSIFGLCPHMTEDNKDLIQGKDLLTAYYDVDYEKNAKGSNYW |
| Form | Liquid |
| Quality control testing | 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain. |
| Storage Buffer | In 20mM Tris-HCl pH 8.0 (10% glycerol, 0.1 M NaCl, 1 mM DTT) |
| Gene ID | 14827 |
Más información
Mouse Pdia3 (P27773, 25 a.a. - 505 a.a.) partial length recombinant protein with His tag expressed in Escherichia coli.