PHPT1 (Human) Recombinant Protein
  • PHPT1 (Human) Recombinant Protein

PHPT1 (Human) Recombinant Protein

Ref: AB-P8010
PHPT1 (Human) Recombinant Protein

Información del producto

Human PHPT1 (Q9NRX4, 1 a.a. - 125 a.a.) full length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name PHPT1
Gene Alias CGI-202|DKFZp564M173|HSPC141|PHP14|bA216L13.10
Gene Description phosphohistidine phosphatase 1
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In 20mM Tris-HCl pH 8.0 (10% glycerol, 0.2 M NaCl, 2 mM DTT)
Gene ID 29085

Enviar un mensaje


PHPT1 (Human) Recombinant Protein

PHPT1 (Human) Recombinant Protein