ATP1B1 (Human) Recombinant Protein
  • ATP1B1 (Human) Recombinant Protein

ATP1B1 (Human) Recombinant Protein

Ref: AB-P8003
ATP1B1 (Human) Recombinant Protein

Información del producto

Human ATP1B1 (P05026, 63 a.a. - 303 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system.
Información adicional
Size 250 ug
Gene Name ATP1B1
Gene Alias ATP1B|MGC1798
Gene Description ATPase, Na+/K+ transporting, beta 1 polypeptide
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq EFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 481

Enviar un mensaje


ATP1B1 (Human) Recombinant Protein

ATP1B1 (Human) Recombinant Protein