Ctsd (Mouse) Recombinant Protein Ver mas grande

Ctsd (Mouse) Recombinant Protein

AB-P7996

Producto nuevo

Ctsd (Mouse) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.


Hoja técnica

Size 20 ug
Gene Name Ctsd
Gene Alias CD|CatD
Gene Description cathepsin D
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq IIRIPLRKFTSIRRTMTEVGGSVEDLILKGPITKYSMQSSPKTTEPVSELLKNYLDAQYYGDIGIGTPPQCFTVVFDTGSSNLWVPSIHCKILDIACWVHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSDQSKARGIKVEKQIFGEATKQPGIVFVAAKFDGILGMGYPHISVNNVLPVFDNLMQQKLVDKNIFSFYLNRDPEGQPGGELMLGGTDSKYYHGELSYLNVTRKAYWQVHMDQL
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 13033

Más información

Mouse Ctsd (P18242, 21 a.a. - 410 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system.

Consulta sobre un producto

Ctsd (Mouse) Recombinant Protein

Ctsd (Mouse) Recombinant Protein