Ctsd (Mouse) Recombinant Protein
  • Ctsd (Mouse) Recombinant Protein

Ctsd (Mouse) Recombinant Protein

Ref: AB-P7996
Ctsd (Mouse) Recombinant Protein

Información del producto

Mouse Ctsd (P18242, 21 a.a. - 410 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system.
Información adicional
Size 20 ug
Gene Name Ctsd
Gene Alias CD|CatD
Gene Description cathepsin D
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq IIRIPLRKFTSIRRTMTEVGGSVEDLILKGPITKYSMQSSPKTTEPVSELLKNYLDAQYYGDIGIGTPPQCFTVVFDTGSSNLWVPSIHCKILDIACWVHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSDQSKARGIKVEKQIFGEATKQPGIVFVAAKFDGILGMGYPHISVNNVLPVFDNLMQQKLVDKNIFSFYLNRDPEGQPGGELMLGGTDSKYYHGELSYLNVTRKAYWQVHMDQL
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 13033

Enviar un mensaje


Ctsd (Mouse) Recombinant Protein

Ctsd (Mouse) Recombinant Protein