Cd200r1 (Mouse) Recombinant Protein
  • Cd200r1 (Mouse) Recombinant Protein

Cd200r1 (Mouse) Recombinant Protein

Ref: AB-P7991
Cd200r1 (Mouse) Recombinant Protein

Información del producto

Mouse Cd200r1 (Q9ES57, 261 a.a. - 238 a.a.) partial length recombinant protein with hIgG-His tag expressed in Baculovirus expression system.
Información adicional
Size 100 ug
Gene Name Cd200r1
Gene Alias CD200R|Mox2r|OX2R
Gene Description CD200 receptor 1
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq TDKNQTTQNNSSSPLTQVNTTVSVQIGTKALLCCFSIPLTKAVLITWIIKLRGLPSCTIAYKVDTKTNETSCLGRNITWASTPDHSPELQISAVTLQHEGTYTCETVTPEGNFEKNYDLQVLVPPEVTYFPEKNRSAVCEAMAGKPAAQISWSPDGDCVTTSESHSNGTVTVRSTCHWEQNNVSDVSCIVSHLTGNQSLSIELSRGGNQSLRP
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 57781

Enviar un mensaje


Cd200r1 (Mouse) Recombinant Protein

Cd200r1 (Mouse) Recombinant Protein