TNFSF8 (Human) Recombinant Protein
  • TNFSF8 (Human) Recombinant Protein

TNFSF8 (Human) Recombinant Protein

Ref: AB-P7978
TNFSF8 (Human) Recombinant Protein

Información del producto

Human TNFSF8 (P28908, 19 a.a. - 379 a.a.) partial length recombinant protein with hIgG-His tag expressed in Baculovirus expression system.
Información adicional
Size 100 ug
Gene Name TNFRSF8
Gene Alias CD30|D1S166E|KI-1
Gene Description tumor necrosis factor receptor superfamily, member 8
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPC
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 943

Enviar un mensaje


TNFSF8 (Human) Recombinant Protein

TNFSF8 (Human) Recombinant Protein